DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and Adgrg2

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:NP_852031.1 Gene:Adgrg2 / 266735 RGDID:628618 Length:1013 Species:Rattus norvegicus


Alignment Length:437 Identity:94/437 - (21%)
Similarity:145/437 - (33%) Gaps:151/437 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   629 QPVVCESPKNNTKVLHDLQ-VAKMFKSP-------PEKVLKYLK---DIIANSKNSIVPADIFLI 682
            |.||..|....|.:.|.|. |.....||       ||||:....   :.:.|:            
  Rat   315 QHVVASSSLPQTDLSHTLSPVQSSIPSPTTAAPSVPEKVVAISTPPGETVVNT------------ 367

  Fly   683 YKIFQSVHEIHSSNSEFQQTTKDLTNWKNAIYEIFDIYNVLIGLDSKVIKMSAEL-NATNMFLKS 746
                .||.::.:..|:.::.                     :.|.|....::.|: |..:..|.|
  Rat   368 ----SSVPDLEAQVSQMEKA---------------------LSLGSLEPNLAGEMVNRVSKLLHS 407

  Fly   747 FEMLFDTLSLNNLSFTQIDNGEEHLNDFNSETIDYDDIGVSVYVSKYILYFSIIPSIANVSGIAL 811
            ...|...|:...|..  :|.....|| |:|.||....                 ||:|    :|:
  Rat   408 PLALLAPLAQRLLKV--VDAIGLQLN-FSSTTISLTS-----------------PSLA----LAV 448

  Fly   812 F-ANNNKKNTPTKLKGAFKNEHYRFLQVNHNINDVVNEPDLELAAY-LPIELIDTLQASTNKTND 874
            . .|.:..||.|     |..:....|||:..    ...|...:.|. ||..|:..|.||     :
  Rat   449 IRVNASNFNTTT-----FAAQDPANLQVSLE----AQAPKNSIGAITLPSSLMSNLPAS-----E 499

  Fly   875 VIVVIKV----YSNDELFQQ-SVRNLTLLSRVVSISLPGYSSFLPVPVPLIFRKSKN-----KKV 929
            |.:..:|    :....|||. |:.||:|:|.|:|.|:...:         |...::|     |.:
  Rat   500 VELASRVQFNFFETPALFQDPSLENLSLISYVISSSVTNMT---------IKNLTRNVTVALKHI 555

  Fly   930 NPPG-----SCLVWNYE------GW-IDGYSMLSYFENNEGIALCRLRRLAPTGYFLEKKISIEN 982
            ||..     .|:.|:..      || .||.|:.   |......:|....|...|..|:       
  Rat   556 NPSQDDLTVKCVFWDLNRNGGRGGWSSDGCSVK---EKRMNETICTCSHLTSFGILLD------- 610

  Fly   983 HIINHDLRMSNTKLNGN-------IIYV------ILLSCCILMFIGF 1016
                    :|.|.|..:       |.|:      |.||..::.:|.|
  Rat   611 --------LSRTSLPPSQMMALTFITYIGCGLSSIFLSVTLVTYIAF 649

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
Adgrg2NP_852031.1 GPS 566..608 CDD:280071 11/44 (25%)
7tm_4 621..871 CDD:304433 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.