DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and ADGRG3

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_005255899.1 Gene:ADGRG3 / 222487 HGNCID:13728 Length:596 Species:Homo sapiens


Alignment Length:120 Identity:27/120 - (22%)
Similarity:53/120 - (44%) Gaps:32/120 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 DDLFEIQNVGNIPICLKISTEPKAFNEQFCYGSNIIAMDLQNFELSKVSQ---------FLKKM- 151
            :::::|.|:.:..:|.   |:.:......|...|:....| |:|...:.:         |||.: 
Human    36 NNMYDIFNLNDKALCF---TKCRQSGSDSCNVENLQRYWL-NYEAHLMKEGLTQKVNTPFLKALV 96

  Fly   152 -NIS-----DFWL---------PIRRNDELMPYEVRLPGKSWRKEI--NRSLIHL 189
             |:|     ||:.         .:.::::..|..|||| ||..:.:  |||::.|
Human    97 QNLSTNTAEDFYFSLEPSQVPRQVMKDEDKPPDRVRLP-KSLFRSLPGNRSVVRL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
ADGRG3XP_005255899.1 GPS 213..255 CDD:280071
7tm_4 355..564 CDD:304433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.