DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43968 and ADGRG5

DIOPT Version :9

Sequence 1:	NP_001262238.1	Gene:	CG43968 / 14462915	FlyBaseID:	FBgn0264699	Length:	1026	Species:	Drosophila melanogaster
Sequence 2:	NP_001291305.1	Gene:	ADGRG5 / 221188	HGNCID:	19010	Length:	528	Species:	Homo sapiens

Alignment Length:	132	Identity:	35/132 - (26%)
Similarity:	54/132 - (40%)	Gaps:	32/132 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   311 IKMSLSEDF---QIVSKGLKWIPTLSKQIVKSSSAVEMVLEIDH-----RSKGVRLV-IY--NRK 364
            :...||.||   .:.|..||.:|....|..:...|::...|:..     |.:.:||: ||  |..
Human    76 LAFKLSCDFSGLSLTSATLKRVPQAGGQHARGQHAMQFPAELTRDACKTRPRELRLICIYFSNTH 140

  Fly   365 YLWKNNNS-----YVGVKCFALLKYGTLKNVRLDL---IWENQE-QSYSILKVNIVSSYRTEYWC 420
            :....|||     ||   ..|.|.:|.:.|:|..:   .|.||. :.|::..|         :|.
Human   141 FFKDENNSSLLNNYV---LGAQLSHGHVNNLRDPVNISFWHNQSLEGYTLTCV---------FWK 193

  Fly   421 EG 422
            ||
Human   194 EG 195

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG43968	NP_001262238.1	None
ADGRG5	NP_001291305.1	GPS	187..232	CDD:307782	4/18 (22%)
		7tmB2_GPR114	245..518	CDD:320559
		TM helix 1	247..272	CDD:320559
		TM helix 2	281..303	CDD:320559
		TM helix 3	315..342	CDD:320559
		TM helix 4	355..375	CDD:320559
		TM helix 5	409..438	CDD:320559
		TM helix 6	451..478	CDD:320559
		TM helix 7	482..507	CDD:320559
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4193
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810