DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and adgre14

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_021330419.1 Gene:adgre14 / 108182849 ZFINID:ZDB-GENE-131120-49 Length:505 Species:Danio rerio


Alignment Length:262 Identity:62/262 - (23%)
Similarity:107/262 - (40%) Gaps:60/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   783 DIGVSVYVSKYILYFSIIPSIANVSGIALFAN----NNK-------KNTPTKLKGAF---KNEHY 833
            |..|::::|.         |.||.:.:..:.|    ||:       |.|.|....:|   ..|..
Zfish     4 DAAVNIHMSS---------SSANPNELTSYGNRVLINNEELMSTLVKQTDTSANVSFTLADVEGR 59

  Fly   834 RFLQVNHNINDVVNEPDLELA-AYLPIELIDTLQASTNKTNDVIVVIKVYSN-DELFQQSVRNL- 895
            .|:...|...|.:  |.|... ..:.|:||. :..:.|.|....|:...|:. :.|.:....|. 
Zfish    60 VFMVGPHVTLDEI--PRLHTRNCSIDIDLIG-IANNNNGTRSAAVIFLGYNTMENLLKADFFNAT 121

  Fly   896 -----TLLSRVVSISLP-GYSSFLPVPVPLIFRKSKNKKVNPPG--SCLVWNYEGWI-DGYSMLS 951
                 |::|.|:|::|| ..::.|..||...||..  ::.:|.|  ||:.||...|| ||.|:|:
Zfish   122 NDTVNTMMSSVISVTLPKTTNTALSKPVNFTFRHI--REFDPSGSFSCVYWNISKWIVDGCSVLN 184

  Fly   952 YFENNEGIALCRLRRLAPTGYFLEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCILMFIGF 1016
               .|....:|....|:.....::.:    :|....|..:       |::.|:    |::  :|.
Zfish   185 ---TNRSFTVCSCVHLSTFALIMQTR----SHPPESDSLL-------NVLNVV----CVI--VGL 229

  Fly  1017 LF 1018
            ||
Zfish   230 LF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
adgre14XP_021330419.1 GPS 167..205 CDD:197639 12/40 (30%)
7tm_GPCRs 214..476 CDD:333717 7/31 (23%)
TM helix 1 217..241 CDD:320095 6/28 (21%)
TM helix 2 250..271 CDD:320095
TM helix 3 285..307 CDD:320095
TM helix 4 331..347 CDD:320095
TM helix 5 365..388 CDD:320095
TM helix 6 412..435 CDD:320095
TM helix 7 439..464 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.