DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43968 and adgre9

DIOPT Version :9

Sequence 1:NP_001262238.1 Gene:CG43968 / 14462915 FlyBaseID:FBgn0264699 Length:1026 Species:Drosophila melanogaster
Sequence 2:XP_021333151.1 Gene:adgre9 / 101883848 ZFINID:ZDB-GENE-121214-61 Length:660 Species:Danio rerio


Alignment Length:400 Identity:82/400 - (20%)
Similarity:145/400 - (36%) Gaps:118/400 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   633 CESPKNNTKVLHDLQVAKMFKSPPEKVLK--YLKDIIANSKNSIVPADIFLIYKIFQSVH-EIHS 694
            |.:..::...|.|:..:  ..||.:.|..  .|.::|:|....:.|.|......:..:.. ::.:
Zfish   122 CRADTHSCTCLGDMTTS--VGSPNQTVASTTNLLNLISNMSGQLSPTDAGNFLSVVDAAQMKVST 184

  Fly   695 SNSEFQQTTKDLTNWKNAIYEIFDIYNVLIGLDSKVIKMSAELNAT-NMFLKSFEMLFDTLSLNN 758
            |:|..:::|  |.::.||....|:  |:          :||.:.|| ||.:|:       ::|||
Zfish   185 SDSPVEKST--LVSFGNAYLNAFE--NL----------VSALVVATDNMTVKN-------IALNN 228

  Fly   759 LSFTQIDNGEEHLNDFNSETIDYDDIGVSVYVSKYILYFSIIPSIANVSGIALFANNNKKNTPTK 823
            ...|.:..|      .|:...|...|    |.....|...:|       |||      |::....
Zfish   229 TEVTVLAIG------VNASAADIPPI----YTKTAQLEIDLI-------GIA------KQSISKS 270

  Fly   824 LKGAFKNEHYRFLQVNHNINDVVNEPDLELAAYLPIELIDTLQASTNKTNDVIVVIKVYSNDELF 888
            ...||         |:::..|.:.:||          ..:|.: :|.||....|:....|.    
Zfish   271 ASVAF---------VSYSAMDSILKPD----------FFNTSE-NTVKTMMSTVISATLSQ---- 311

  Fly   889 QQSVRNLTLLSRVVSISLPGYSSFLPVPVPLIFRKSKNKKVNPPGSCLVWNYEGWI-DGYSMLSY 952
                .|.|.|::.|:.:|.....|.|        ||..       ||:.||...|| ||.|:|: 
Zfish   312 ----TNNTALTKPVNFTLKHIQGFNP--------KSSL-------SCVYWNDSEWIVDGCSVLN- 356

  Fly   953 FENNEGIALCRLRRLAPTGYFLEKKISIENHIINHDLRMSNTKLNGNIIYVILLSCCI------- 1010
              :|....:|....|:.....::..              |....:.:::.::.|.|.|       
Zfish   357 --SNSSHTVCSCVHLSTFALIMQTS--------------STPPESSDLLELLNLVCVIVGLVFFS 405

  Fly  1011 LMFIGFLFCK 1020
            |..:.|..|:
Zfish   406 LALLSFALCQ 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43968NP_001262238.1 None
adgre9XP_021333151.1 GPS 335..380 CDD:197639 14/68 (21%)
7tm_GPCRs 389..648 CDD:333717 6/26 (23%)
TM helix 1 389..413 CDD:320095 5/23 (22%)
TM helix 2 422..443 CDD:320095
TM helix 3 457..479 CDD:320095
TM helix 4 503..519 CDD:320095
TM helix 5 537..560 CDD:320095
TM helix 6 584..609 CDD:320095
TM helix 7 611..636 CDD:320095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4193
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.