DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43783 and MMM1

DIOPT Version :9

Sequence 1:NP_001261606.1 Gene:CG43783 / 14462845 FlyBaseID:FBgn0264305 Length:1248 Species:Drosophila melanogaster
Sequence 2:NP_013095.1 Gene:MMM1 / 850654 SGDID:S000003929 Length:426 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:53/233 - (22%)
Similarity:96/233 - (41%) Gaps:50/233 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   938 PSGSIVWANVLLGRCLY-----SWLHDAMLHEKLKEVLQKKLNSIKLPSFMEEVIITNIYLGES- 996
            |:.|:.|.|||:.:.:.     :|..|.:|| .|.:.:.:|  |..||.:::.:.||.:..|:. 
Yeast   194 PAESLDWFNVLVAQIIQQFRSEAWHRDNILH-SLNDFIGRK--SPDLPEYLDTIKITELDTGDDF 255

  Fly   997 PLLCHRVSQPMLDERGVWIDADVTYEGLAHITVTTKLNLLRIRSKTKSPMATDNVPTTSMLP--- 1058
            |:..:...|...:.....::|.:..:...|:|:..:..||....|          |..:.||   
Yeast   256 PIFSNCRIQYSPNSGNKKLEAKIDIDLNDHLTLGVETKLLLNYPK----------PGIAALPINL 310

  Fly  1059 ----EQSQDLRSLSEVNSENVIYDSDAESSGGSSTESESPPPGNAPENAAG-TEFFQNSPGNARR 1118
                .:.|...::|..|:|..     |.:|.|||:|       |..|..:| ...|..|| ..|.
Yeast   311 VVSIVRFQACLTVSLTNAEEF-----ASTSNGSSSE-------NGMEGNSGYFLMFSFSP-EYRM 362

  Fly  1119 IFKIVDRIAA----------SNLFQYATELPYVQRAME 1146
            .|:|...|.:          .::.:|..:..:|:|.:|
Yeast   363 EFEIKSLIGSRSKLENIPKIGSVIEYQIKKWFVERCVE 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43783NP_001261606.1 None
MMM1NP_013095.1 MMM1 95..418 CDD:402078 53/233 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13466
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.