DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and SPINK2

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001258647.1 Gene:SPINK2 / 6691 HGNCID:11245 Length:134 Species:Homo sapiens


Alignment Length:44 Identity:17/44 - (38%)
Similarity:29/44 - (65%) Gaps:3/44 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 CPRNYEPVCGSNLVTYPNRCEFDCVRRNVERQGRSMGLLRDGTC 79
            |||::.|||||::.||.|.|.. |::  :...|.::.::|:|.|
Human    94 CPRHFNPVCGSDMSTYANECTL-CMK--IREGGHNIKIIRNGPC 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 16/42 (38%)
SPINK2NP_001258647.1 Kazal_1 86..134 CDD:395004 16/42 (38%)

Return to query results.
Submit another query.