DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and Spink14

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001034307.2 Gene:Spink14 / 433178 MGIID:3646952 Length:96 Species:Mus musculus


Alignment Length:96 Identity:28/96 - (29%)
Similarity:42/96 - (43%) Gaps:28/96 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILVALCLLLALTISP-------------ISCDDTEKV-----VRPICPCPRNYEPVCGSNLVTY 51
            |:|.::.|.|.:..:|             |.| ..:||     .:.:.|||...:|:||:|.|||
Mouse     8 SVLFSIMLHLVILAAPGARVWWPTHGLIKIKC-PYKKVNLSWFNKTVDPCPDLKQPICGTNFVTY 71

  Fly    52 PNRCEFDCVRRNVERQGRSMGLLR---DGTC 79
            .|.|.. ||     ...:|.|.:|   :|.|
Mouse    72 DNPCIL-CV-----ESLKSGGRIRYYYNGRC 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 17/45 (38%)
Spink14NP_001034307.2 KAZAL_FS 55..96 CDD:412159 18/46 (39%)

Return to query results.
Submit another query.