DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and Fst

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001288302.1 Gene:Fst / 14313 MGIID:95586 Length:344 Species:Mus musculus


Alignment Length:48 Identity:19/48 - (39%)
Similarity:28/48 - (58%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ICPCPRNYEP-VCGSNLVTYPNRCEFDCVRRNVERQGRSMGLLRDGTC 79
            |||.|.:.|. :||::.|||.:.|.   :|:.....|||:||..:|.|
Mouse   195 ICPEPSSSEQYLCGNDGVTYSSACH---LRKATCLLGRSIGLAYEGKC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 15/43 (35%)
FstNP_001288302.1 FOLN 94..117 CDD:128570
KAZAL 117..164 CDD:197624
FOLN 167..190 CDD:128570
KAZAL 192..239 CDD:197624 18/46 (39%)
KAZAL 270..316 CDD:197624
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..344
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.