DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and LOC1279932

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_319718.1 Gene:LOC1279932 / 1279932 VectorBaseID:AGAMI1_009868 Length:63 Species:Anopheles gambiae


Alignment Length:80 Identity:26/80 - (32%)
Similarity:34/80 - (42%) Gaps:18/80 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFLSIL-VALCLLLALTISPISCDDTEKVVRPICPCPRNYEPVCGSNLVTYPNRCEFDCVRRNV 64
            ||.|.:| ..||.:|| .....||.          .||.||.||||::..||.|.|..:|.    
Mosquito     1 MKLLFLLSFLLCAILA-AAGKYSCP----------ACPANYLPVCGTDGKTYANECALECT---- 50

  Fly    65 ERQGRSMGLLRDGTC 79
              ...::.:.|.|.|
Mosquito    51 --VAPAVKVARSGEC 63

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 15/42 (36%)
LOC1279932XP_319718.1 KAZAL 23..63 CDD:197624 16/55 (29%)

Return to query results.
Submit another query.