DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and FST

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_005248457.1 Gene:FST / 10468 HGNCID:3971 Length:357 Species:Homo sapiens


Alignment Length:48 Identity:19/48 - (39%)
Similarity:28/48 - (58%) Gaps:4/48 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 ICPCPRNYEP-VCGSNLVTYPNRCEFDCVRRNVERQGRSMGLLRDGTC 79
            |||.|.:.|. :||::.|||.:.|.   :|:.....|||:||..:|.|
Human   195 ICPEPASSEQYLCGNDGVTYSSACH---LRKATCLLGRSIGLAYEGKC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 15/43 (35%)
FSTXP_005248457.1 FOLN 94..117 CDD:128570
KAZAL 117..164 CDD:197624
FOLN 167..190 CDD:128570
KAZAL 192..239 CDD:197624 18/46 (39%)
KAZAL 283..329 CDD:197624
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.