DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and spink2.9

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001373550.1 Gene:spink2.9 / 100538025 ZFINID:ZDB-GENE-141216-159 Length:76 Species:Danio rerio


Alignment Length:57 Identity:21/57 - (36%)
Similarity:27/57 - (47%) Gaps:8/57 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVALCLLLALTISPISCDDTEKVVRPIC------PCPRNYEPVCGSNLVTYPNRCE 56
            :|..:.|||.|::...:.|....|  |.|      .|...|.|||||:..||.|.||
Zfish     1 MLAQIVLLLCLSVMATAADKCPSV--PNCSRYHPHACTMEYWPVCGSDGNTYGNECE 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 12/21 (57%)
spink2.9NP_001373550.1 KAZAL 32..76 CDD:197624 12/24 (50%)

Return to query results.
Submit another query.