DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and spink2.7

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001373549.1 Gene:spink2.7 / 100537819 ZFINID:ZDB-GENE-091118-100 Length:78 Species:Danio rerio


Alignment Length:58 Identity:22/58 - (37%)
Similarity:29/58 - (50%) Gaps:10/58 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ILVALCLLLALTISPISCDDTEKVVRPICP--------CPRNYEPVCGSNLVTYPNRC 55
            :|..:.|||:|.....:.||...|  |.|.        |.|.|.||||::.:||||.|
Zfish     1 MLAQIVLLLSLAAMATAADDCPSV--PNCSQYPQQLPICNREYRPVCGTDGITYPNEC 56

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 12/20 (60%)
spink2.7NP_001373549.1 KAZAL_FS 34..78 CDD:412159 12/23 (52%)

Return to query results.
Submit another query.