DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and Spink10

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:XP_002728606.3 Gene:Spink10 / 100361300 RGDID:2320365 Length:160 Species:Rattus norvegicus


Alignment Length:66 Identity:22/66 - (33%)
Similarity:29/66 - (43%) Gaps:14/66 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SILVALCLLLALTISPISCDDT---EKVVR--PICP--------CPRNYEPVCGSNLVTYPNRCE 56
            |:.:.:..:||| :.....:.|   .|.||  |.|.        |.|...||||:|..||.|.|.
  Rat    81 SLWIKIIFILAL-VGLFYYETTFTFSKQVRHKPDCDKYKEFPNRCTREINPVCGTNGHTYDNECI 144

  Fly    57 F 57
            |
  Rat   145 F 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 12/22 (55%)
Spink10XP_002728606.3 KAZAL_FS 37..>71 CDD:412159
Kazal_1 114..157 CDD:395004 13/32 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.