DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG44008 and Gm10267

DIOPT Version :10

Sequence 1:NP_001260398.1 Gene:CG44008 / 14462750 FlyBaseID:FBgn0264750 Length:79 Species:Drosophila melanogaster
Sequence 2:NP_001268399.1 Gene:Gm10267 / 100042855 MGIID:3642556 Length:85 Species:Mus musculus


Alignment Length:66 Identity:21/66 - (31%)
Similarity:32/66 - (48%) Gaps:16/66 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALTISPISCDDTEKVVRPI------CP-------CPRNYEPVCGSNLVTYPNRCEFDCV--RR 62
            ::.:|:|.:.|.::..:.|.|      |.       |.|.|.|||.:|..||.|:|.| |:  |.
Mouse     9 VIYITLSFLLCSESHFIRRAIYKHIVMCRGFSSKRICTREYFPVCATNGRTYFNKCIF-CLAYRE 72

  Fly    63 N 63
            |
Mouse    73 N 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG44008NP_001260398.1 KAZAL_FS 36..79 CDD:238052 15/30 (50%)
Gm10267NP_001268399.1 Kazal_1 41..85 CDD:395004 15/34 (44%)

Return to query results.
Submit another query.