DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43796 and CG14391

DIOPT Version :10

Sequence 1:NP_001260254.1 Gene:CG43796 / 14462726 FlyBaseID:FBgn0264340 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_650225.2 Gene:CG14391 / 41567 FlyBaseID:FBgn0038078 Length:135 Species:Drosophila melanogaster


Alignment Length:112 Identity:44/112 - (39%)
Similarity:68/112 - (60%) Gaps:3/112 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VAKNAEVHRRGILGFAPR-IGLVNVDYDDLDRIDNFYLETQRYRDYYRDPHNILHKPERFRQHQG 67
            |:|.::..|:.|..|.|. :.|..:...::.|||.||||.|:|||:||||:..:|.|..|..|:|
  Fly    13 VSKKSQKDRQMIRKFVPEAVDLATISRAEIYRIDTFYLECQKYRDHYRDPYGKVHCPAFFHLHKG 77

  Fly    68 KCSIKLDTSVQNLTRPIRWVKEKMPVLYPPSRDTAMMLG--TPISSR 112
            ||.||||.||..:|:.|....::.|:::|...:.:|.||  .|:.|:
  Fly    78 KCGIKLDQSVIKMTQAIAATVDRQPIVFPLIPNKSMFLGGSIPMGSQ 124

Return to query results.
Submit another query.