DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43796 and CG13110

DIOPT Version :10

Sequence 1:NP_001260254.1 Gene:CG43796 / 14462726 FlyBaseID:FBgn0264340 Length:127 Species:Drosophila melanogaster
Sequence 2:NP_609282.1 Gene:CG13110 / 34253 FlyBaseID:FBgn0032111 Length:133 Species:Drosophila melanogaster


Alignment Length:103 Identity:44/103 - (42%)
Similarity:65/103 - (63%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VAKNAEVHRRGILGFAPRIGLVNVDYDDLDRIDNFYLETQRYRDYYRDPHNILHKPERFRQHQGK 68
            |:|::.:||..|.. ..:.||..:||..:..:|.||||.|.||||::||:|.:|||.||..:.||
  Fly    11 VSKSSRIHRLSIFN-CDKPGLKVLDYAAVRGVDRFYLECQDYRDYFKDPYNRVHKPIRFTSYAGK 74

  Fly    69 CSIKLDTSVQNLTRPIRWVKEKMPVLYPPSRDTAMMLG 106
            |.:||||.|:.|:.|..|..::.|::||....:.|.||
  Fly    75 CDVKLDTDVEVLSEPTLWRIDRQPIVYPIDYHSDMALG 112

Return to query results.
Submit another query.