powered by:
Protein Alignment CG43774 and Anapc2
DIOPT Version :9
Sequence 1: | NP_608816.2 |
Gene: | CG43774 / 14462693 |
FlyBaseID: | FBgn0264296 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_780509.2 |
Gene: | Anapc2 / 99152 |
MGIID: | 2139135 |
Length: | 837 |
Species: | Mus musculus |
Alignment Length: | 46 |
Identity: | 14/46 - (30%) |
Similarity: | 23/46 - (50%) |
Gaps: | 1/46 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 49 SVPANQMAVPVQTTTTTVMPAQCATHWQEPQTMSALPPKYDQAVAA 94
|.|..::.|...|.:|.::| ..|......:|..|:|||.::..||
Mouse 29 SRPGQELLVAWNTVSTGLVP-PAALGLASSRTSGAVPPKEEELRAA 73
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3734 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.