DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43774 and ANAPC2

DIOPT Version :9

Sequence 1:NP_608816.2 Gene:CG43774 / 14462693 FlyBaseID:FBgn0264296 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_037498.1 Gene:ANAPC2 / 29882 HGNCID:19989 Length:822 Species:Homo sapiens


Alignment Length:46 Identity:14/46 - (30%)
Similarity:23/46 - (50%) Gaps:1/46 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SVPANQMAVPVQTTTTTVMPAQCATHWQEPQTMSALPPKYDQAVAA 94
            |.|..::.|...|.:|.::| ..|......:|..|:|||.::..||
Human    14 SRPGQELLVAWNTVSTGLVP-PAALGLVSSRTSGAVPPKEEELRAA 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43774NP_608816.2 None
ANAPC2NP_037498.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 450..495
Cullin homology. /evidence=ECO:0000269|PubMed:9469815 502..700
Cullin <512..694 CDD:395716
APC2 757..817 CDD:198081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3734
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.