DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43774 and apc-2

DIOPT Version :9

Sequence 1:NP_608816.2 Gene:CG43774 / 14462693 FlyBaseID:FBgn0264296 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_498762.2 Gene:apc-2 / 176139 WormBaseID:WBGene00000143 Length:731 Species:Caenorhabditis elegans


Alignment Length:42 Identity:10/42 - (23%)
Similarity:18/42 - (42%) Gaps:5/42 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ANQMAVPVQTTTTTVMPAQCATHWQ--EPQTMSALPPKYDQA 91
            |....||:...:..::.:.   :|.  |.:...||.|:..||
 Worm   482 AGNYDVPIIPISACIISSH---YWPKLETEKTEALMPQPLQA 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43774NP_608816.2 None
apc-2NP_498762.2 CULLIN 408..553 CDD:214545 10/42 (24%)
APC2 662..723 CDD:198081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3734
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.