powered by:
Protein Alignment CG43774 and apc-2
DIOPT Version :9
Sequence 1: | NP_608816.2 |
Gene: | CG43774 / 14462693 |
FlyBaseID: | FBgn0264296 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_498762.2 |
Gene: | apc-2 / 176139 |
WormBaseID: | WBGene00000143 |
Length: | 731 |
Species: | Caenorhabditis elegans |
Alignment Length: | 42 |
Identity: | 10/42 - (23%) |
Similarity: | 18/42 - (42%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 ANQMAVPVQTTTTTVMPAQCATHWQ--EPQTMSALPPKYDQA 91
|....||:...:..::.:. :|. |.:...||.|:..||
Worm 482 AGNYDVPIIPISACIISSH---YWPKLETEKTEALMPQPLQA 520
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43774 | NP_608816.2 |
None |
apc-2 | NP_498762.2 |
CULLIN |
408..553 |
CDD:214545 |
10/42 (24%) |
APC2 |
662..723 |
CDD:198081 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3734 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.