DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43797 and Clec4a

DIOPT Version :10

Sequence 1:NP_001260012.1 Gene:CG43797 / 14462692 FlyBaseID:FBgn0264341 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_001005899.2 Gene:Clec4a / 474143 RGDID:1359662 Length:240 Species:Rattus norvegicus


Alignment Length:169 Identity:30/169 - (17%)
Similarity:67/169 - (39%) Gaps:40/169 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 IEQKESKQAINENDDTKVEGIETTTSVNLIKKK--------------------KYVIVDKALNWY 132
            :|:|::.:.|...:      :....:|.|:::|                    |:.......:|.
  Rat    76 LEEKKAIKGITHKE------LNCIKNVLLMEEKSWSCCPKNWKPFGSHCYWVTKHTSTYSKASWN 134

  Fly   133 NAVKFCQEIGGKLAEFSDEHEYDTVISTVEPDTCYWIGIRSYNNEHQSLRTDNRPLYLKMADM-- 195
            .:.|.|..:|..|.....:.|.|.:...:..|..|:||:  :::.|:..:..::..|...|..  
  Rat   135 ESEKNCFSMGAHLLVIHSKEEQDFITGILNRDAAYFIGL--WDSGHRQWQWVSQTPYNASATFWH 197

  Fly   196 ---PNNNIFNGENCV---GIQNGF-MHDLWCNLSYYSIC 227
               |::   :.|.||   .:.:|: .:|:.|:....|:|
  Rat   198 KGEPSS---DDEKCVIINHLNSGWGWNDIPCSGKQQSVC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43797NP_001260012.1 CLECT 122..227 CDD:153057 22/113 (19%)
Clec4aNP_001005899.2 ITIM motif 5..10
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..38
CLECT_DC-SIGN_like 107..235 CDD:153060 24/132 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.