DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43797 and CLEC5A

DIOPT Version :10

Sequence 1:NP_001260012.1 Gene:CG43797 / 14462692 FlyBaseID:FBgn0264341 Length:232 Species:Drosophila melanogaster
Sequence 2:NP_037384.1 Gene:CLEC5A / 23601 HGNCID:2054 Length:188 Species:Homo sapiens


Alignment Length:139 Identity:31/139 - (22%)
Similarity:52/139 - (37%) Gaps:33/139 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GIETTTSVNLIKKKK--------YVIVDKALNWYNAVKFCQEIGGKLAEFSDEHEYDTVISTVEP 163
            |..||.|...:..|.        :.:.....:|..:..||:..|..||..:...:...:....:.
Human    60 GFITTRSYGTVCPKDWEFYQARCFFLSTSESSWNESRDFCKGKGSTLAIVNTPEKLKFLQDITDA 124

  Fly   164 DTCYWIGIRSYNNEHQSLRTDNRPLYLKMADMPNNNIFNGE--------NC--VGIQNGFMHDLW 218
            :. |:||: .|:.|.:..|            ..||::|||.        ||  :|:...| ....
Human   125 EK-YFIGL-IYHREEKRWR------------WINNSVFNGNVTNQNQNFNCATIGLTKTF-DAAS 174

  Fly   219 CNLSYYSIC 227
            |::||..||
Human   175 CDISYRRIC 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43797NP_001260012.1 CLECT 122..227 CDD:153057 24/114 (21%)
CLEC5ANP_037384.1 CLECT_NK_receptors_like 71..185 CDD:153063 27/128 (21%)

Return to query results.
Submit another query.