DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and Wfdc6b

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_006499938.1 Gene:Wfdc6b / 433502 MGIID:3575430 Length:155 Species:Mus musculus


Alignment Length:61 Identity:16/61 - (26%)
Similarity:27/61 - (44%) Gaps:4/61 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LALKDPICGLKPRVNRCISAKESLVLYGYSESRNICYK-IKNPCQTLVRRFATKEICQKLC 77
            |.|.:.||.|......|::   .|..:.|::...:|.: |...||.....|.:|.:|..:|
Mouse    88 LDLSEDICSLPQDAGPCLA---YLPRWWYNQDTKLCIEFIYGGCQGNPNNFESKAVCTSIC 145

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None