DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and CG2816

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_608803.2 Gene:CG2816 / 33595 FlyBaseID:FBgn0031564 Length:84 Species:Drosophila melanogaster


Alignment Length:59 Identity:18/59 - (30%)
Similarity:26/59 - (44%) Gaps:11/59 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RVNRCISAKESLVLYGYSESRNICYK-IKNPCQTLV--------RRFATKEICQKLCQE 79
            ||..|:....|...:||.||  ..|. ||..|:..:        .||:||..|:..|::
  Fly    27 RVKLCLQPMISGRCFGYVES--YAYNPIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
CG2816NP_608803.2 Kunitz_SCI-I-like 30..81 CDD:438677 15/52 (29%)

Return to query results.
Submit another query.