DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and CG15418

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_608794.1 Gene:CG15418 / 33585 FlyBaseID:FBgn0031554 Length:97 Species:Drosophila melanogaster


Alignment Length:95 Identity:17/95 - (17%)
Similarity:35/95 - (36%) Gaps:28/95 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IYLFILSLAL-----------RLLNVLALKDP----ICGLKPRVNRCISAKESLVLYGYSESRNI 52
            :.|.::.|:|           ::..::|.:.|    :|            :...:.|.|::....
  Fly    13 VLLLVVGLSLGLPSLENQTHEQIEQIIACRQPKAPGLC------------RGHQLRYAYNKKTGN 65

  Fly    53 CYK-IKNPCQTLVRRFATKEICQKLCQEEL 81
            |.. |...|.:....|.|.|.|::.|.:.|
  Fly    66 CESFIYTGCASTENNFLTFEECRRDCMQRL 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
CG15418NP_608794.1 Kunitz-type 41..91 CDD:438633 11/61 (18%)

Return to query results.
Submit another query.