DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and Acp24A4

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001036330.1 Gene:Acp24A4 / 318936 FlyBaseID:FBgn0051779 Length:78 Species:Drosophila melanogaster


Alignment Length:81 Identity:24/81 - (29%)
Similarity:35/81 - (43%) Gaps:5/81 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKIYLFILSLALRLLNVLALKDPICGLKPRVN-RCISAKESLVLYGYSESRNICYK-IKNPCQTL 63
            ||:.:.:........|.||||:.||||....| .|::.   ...:.|....|:|:. |...||..
  Fly     1 MKLLILLFVFIALASNSLALKNEICGLPAAANGNCLAL---FSRWSYDAQYNVCFNFIYGGCQGN 62

  Fly    64 VRRFATKEICQKLCQE 79
            ...|.::|.|...|.|
  Fly    63 ENSFESQEECINKCVE 78

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
Acp24A4NP_001036330.1 Kunitz-type 25..76 CDD:438633 14/53 (26%)

Return to query results.
Submit another query.