DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and Wfdc6a

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:XP_011237710.1 Gene:Wfdc6a / 209351 MGIID:2684968 Length:193 Species:Mus musculus


Alignment Length:62 Identity:14/62 - (22%)
Similarity:30/62 - (48%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LKDPICGLKPRVNRCISAKESLVLYGYSESRNICYK-IKNPCQTLVRRFATKEICQKLCQEE 80
            |:..:|.|......|::   .|..:.|::..::|.: |...||.....|.::.||..:|:::
Mouse   129 LRQDVCSLPQDPGPCLA---YLPRWWYNQETDLCTEFIYGGCQGNPNNFPSEGICTVVCKKK 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
Wfdc6aXP_011237710.1 WAP 89..128 CDD:459672
Kunitz_eppin 132..188 CDD:438654 13/59 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.