DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and K10D3.4

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_492020.1 Gene:K10D3.4 / 172452 WormBaseID:WBGene00010738 Length:922 Species:Caenorhabditis elegans


Alignment Length:62 Identity:16/62 - (25%)
Similarity:27/62 - (43%) Gaps:4/62 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KDPICGLKPRVN-RCISAKESLVLYGYSESRNICYKIK-NPCQTLVRRFATKEICQKLCQEE 80
            |:.:|.....|. ||.|.:.|  .:.::.....|...: |.|:.....||:::.||..|..|
 Worm   625 KNFVCSQPRDVGVRCSSTRIS--RWYFNADSKTCQTFEYNGCEGNRNNFASQKSCQNYCLSE 684

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
K10D3.4NP_492020.1 EB 46..100 CDD:460294
Kunitz_BPTI 170..226 CDD:425421
KU <312..352 CDD:197529
Kunitz_BPTI 410..462 CDD:425421
Kunitz_BPTI 518..571 CDD:425421
Kunitz_BPTI 628..681 CDD:425421 13/54 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.