DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43703 and si:dkeyp-73b11.8

DIOPT Version :10

Sequence 1:NP_001260009.1 Gene:CG43703 / 14462687 FlyBaseID:FBgn0263842 Length:84 Species:Drosophila melanogaster
Sequence 2:NP_001373612.1 Gene:si:dkeyp-73b11.8 / 100333708 ZFINID:ZDB-GENE-131120-176 Length:230 Species:Danio rerio


Alignment Length:76 Identity:19/76 - (25%)
Similarity:30/76 - (39%) Gaps:5/76 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 IYLFILSLALRLLNVLALKDPICGLKPRVNRCISAKESLVLYGYSESRNICYKIK-NPCQTLVRR 66
            |.|||.:|. ..:.....|...|.||....   :..:.:|...|...::.||..: |.......|
Zfish     6 IILFIFALN-HNIQAQTRKPEACTLKQDEG---TGNDVVVYMYYDADKDSCYPFRYNGEGGNSNR 66

  Fly    67 FATKEICQKLC 77
            |.|::.|.:.|
Zfish    67 FITEKQCMRNC 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43703NP_001260009.1 None
si:dkeyp-73b11.8NP_001373612.1 Kunitz_conkunitzin 27..77 CDD:438636 12/52 (23%)
Kunitz_BPTI 92..143 CDD:425421
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.