DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22d and Gr43a

DIOPT Version :9

Sequence 1:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001286158.1 Gene:Gr43a / 35655 FlyBaseID:FBgn0041243 Length:453 Species:Drosophila melanogaster


Alignment Length:206 Identity:46/206 - (22%)
Similarity:78/206 - (37%) Gaps:53/206 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 LINRELLSLVCSLRGNHKGSSSRVRFLLKLYNKLVNLYSKLADCYDCQTVLMMAIFLAAN---II 265
            ::|.|||.| ......:||      .|||   .|.:.:..|..|          :.|.:|   |.
  Fly   277 ILNVELLKL-GYFPAKNKG------LLLK---SLADSHESLGKC----------VHLLSNSFGIA 321

  Fly   266 VCFYMIVYRISLSKMSFFVMLIMFP-----------LAIANNFMDFWLSMKVCDLLQKTGRQTSM 319
            |.|.::...:.|...::|:.|.:..           |.|..:|:...:.::.|.|..:..|:|..
  Fly   322 VLFILVSCLLHLVATAYFLFLELLSKRDNGYLWVQMLWICFHFLRLLMVVEPCHLAARESRKTIQ 386

  Fly   320 ILKLFNDIENMDKDLEISISDFALYCSHRRF---------KFLHCGLFHVNREMGFKMFVASVLY 375
            |:          .::|..:.:..|..:.::|         .|..|||..|||.:......|...|
  Fly   387 IV----------CEIERKVHEPILAEAVKKFWQQLLVVDADFSACGLCRVNRTILTSFASAIATY 441

  Fly   376 LLYLVQFDYMN 386
            |:.|:||...|
  Fly   442 LVILIQFQRTN 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 45/204 (22%)
Gr43aNP_001286158.1 7tm_7 10..449 CDD:285581 44/201 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.