DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22d and Gr36a

DIOPT Version :9

Sequence 1:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_724038.2 Gene:Gr36a / 117488 FlyBaseID:FBgn0045487 Length:391 Species:Drosophila melanogaster


Alignment Length:427 Identity:80/427 - (18%)
Similarity:168/427 - (39%) Gaps:98/427 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FVYVILKSILYSSWLLGIFPFKYEPKKRRLRRSMWLILFGVVISSSLLILMVKQSAEDREHGIML 76
            :|.::||.:.|...::|:..|:.:.::.|:..:...|||.:.|:..:.::::.|.::.    ..|
  Fly     4 WVGLLLKVLYYYGQIIGLINFEIDWQRGRVVAAQRGILFAIAINVLICMVLLLQISKK----FNL 64

  Fly    77 DV-FQRNALLYQ-----ISSLMGVVGVVSI---------------CTVHLRTLWRSKHLEEIYNG 120
            || |.|...|:|     :.||....|:.:|               |.  ||...:..|::::...
  Fly    65 DVYFGRANQLHQYVIIVMVSLRMASGISAILNRWRQRAQLMRLVECV--LRLFLKKPHVKQMSRW 127

  Fly   121 LMLLE-----AKYFCSNAVECPAFDGYVIQKGVVIVVGLLAP-WMVHFGMPDSKLPVLNVLVVSM 179
            .:|::     ...|...|:...:.|    :.|....||:.:. ||         ..::| :.:|.
  Fly   128 AILVKFSVGVVSNFLQMAISMESLD----RLGFNEFVGMASDFWM---------SAIIN-MAISQ 178

  Fly   180 VKLGTLLLALHYHLGVVIIYRFVWLINRELLSLV-----------CSLRGNHKGSSSRVRFLLKL 233
            ..|..|.:..:|||....:.:.:.  ..::||.:           |.|       :.|:..:.||
  Fly   179 HYLVILFVRAYYHLLKTEVRQAIH--ESQMLSEIYPRRAAFMTKCCYL-------ADRIDNIAKL 234

  Fly   234 YNKLVNLYSKLADCYDCQTVLMMA---IFLAANIIVCFYMIVYRISLSKMSFFVMLIMFPLAIAN 295
            .|:|.::.::|...:..|.:::..   ||..|...:.:.:.:..|....:|.....::|      
  Fly   235 QNQLQSIVTQLNQVFGIQGIMVYGGYYIFSVATTYITYSLAINGIEELHLSVRAAALVF------ 293

  Fly   296 NFMDFWLSMKVCDLLQKTGRQTSMILKLFNDIENM--------------DKDLEISISDFALYCS 346
            ::..|:.:..:.:|.        ::||||:|.:.|              |..||.|.....|...
  Fly   294 SWFLFYYTSAILNLF--------VMLKLFDDHKEMERILEERTLFTSALDVRLEQSFESIQLQLI 350

  Fly   347 HRRFKFLHCGLFHVNREMGFKMFVASVLYLLYLVQFD 383
            ....|.....:|.:.|.....|..:.:...::|:|:|
  Fly   351 RNPLKIEVLDIFTITRSSSAAMIGSIITNSIFLIQYD 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 79/422 (19%)
Gr36aNP_724038.2 7tm_7 9..390 CDD:285581 79/422 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.