DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gr22d and Gr59b

DIOPT Version :9

Sequence 1:NP_001259882.1 Gene:Gr22d / 14462661 FlyBaseID:FBgn0045498 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_523818.2 Gene:Gr59b / 117484 FlyBaseID:FBgn0045482 Length:366 Species:Drosophila melanogaster


Alignment Length:235 Identity:52/235 - (22%)
Similarity:89/235 - (37%) Gaps:58/235 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 LNVL----------VVSMVKLGTLLLALHYHLGVVIIYRFVWLINRELLSLVCSLRGNHKGSSSR 226
            :|||          ::.||.:|..|...|       |.|....:||.|..:|       |..|:|
  Fly   160 VNVLRFFFKCNTNNILEMVPMGYFLALWH-------IARGFDCVNRRLDQIV-------KSKSTR 210

  Fly   227 ----VRFLLKLYNKLVNLYSKLADCYDCQTVLMMAIFLAANIIVCFYMIVYRISLSKMSFFVML- 286
                ::.|..|:..|......:...|..|.:..........:|..::..|:...||...|:|:. 
  Fly   211 KHRELQHLWLLHACLTKTALNINKIYAPQMLASRFDNFVNGVIQAYWGAVFTFDLSTPFFWVVYG 275

  Fly   287 -IMFPLAIANNFMDFWLSMKVCDLLQKTGRQTSMILKLFNDIENMDKD----LEI----SISDFA 342
             :.:.:    ..:|::|...:||:.                :|..|..    .|:    .||.:.
  Fly   276 SVQYHV----RCLDYYLIDNMCDVA----------------VEYHDSAKHSWSEVRWTKEISSYV 320

  Fly   343 LYCSHRRFKFLHCGLFHVNREMGFKMFVASVLYLLYLVQF 382
            :|.:..:.:...||||..||.|.|.|..:.:.|:|.|:||
  Fly   321 IYANSTKLQLWSCGLFQANRSMWFAMISSVLYYILVLLQF 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gr22dNP_001259882.1 7tm_7 17..386 CDD:285581 52/235 (22%)
Gr59bNP_523818.2 7tm_7 6..364 CDD:285581 52/235 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.