DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43777 and AT4G31470

DIOPT Version :10

Sequence 1:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_194875.1 Gene:AT4G31470 / 829274 AraportID:AT4G31470 Length:185 Species:Arabidopsis thaliana


Alignment Length:144 Identity:31/144 - (21%)
Similarity:48/144 - (33%) Gaps:51/144 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RMRQLFWDKELAYMGNNHASTLSLKSSQCRSTLRFPHVGEAIALVTPREKLNLKEIYSKAFTPMF 160
            |:..|.|...||...:..|.|   :...|:........||           ||.....|.:||. 
plant    66 RLPPLKWSNSLALYASRWART---RRGDCKLIHSGGPYGE-----------NLFWGSGKGWTPR- 115

  Fly   161 AEYQHVSDPDALLHAFDPDRDFQVR------------HFTNIISDRVSRVGCGVAVGANCNPSIK 213
                     ||:. |:..:..:..|            |:|.::..:.||:||          :|.
plant   116 ---------DAVA-AWASEMKYYDRRTSHCKANGDCLHYTQLVWKKSSRIGC----------AIS 160

  Fly   214 FCH----FLTCYFD 223
            ||.    |:.|.:|
plant   161 FCKTGDTFIICNYD 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43777NP_001261163.1 CAP_euk 64..223 CDD:349399 30/142 (21%)
AT4G31470NP_194875.1 CAP_PR-1 51..185 CDD:349400 31/144 (22%)

Return to query results.
Submit another query.