DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43777 and AT2G19980

DIOPT Version :10

Sequence 1:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:31 Identity:9/31 - (29%)
Similarity:16/31 - (51%) Gaps:7/31 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 HFTNIISDRVSRVGCGVA-------VGANCN 209
            |:|.|::::.:.:|||..       |...||
plant   121 HYTQIVANQSTHLGCGTVRCFKNEYVWVVCN 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43777NP_001261163.1 CAP_euk 64..223 CDD:349399 9/31 (29%)
AT2G19980NP_179588.1 CAP_PR-1 35..165 CDD:349400 9/31 (29%)

Return to query results.
Submit another query.