DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Pi15

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:286 Identity:68/286 - (23%)
Similarity:121/286 - (42%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MILSAVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLGGTRYHAIV------PD 59
            ||:::.:.:::::|.:      |  ..|..:|||...     ..:|:...|...|.:      .|
Mouse    12 MIMNSAVSLVILLSLL------C--EAHTVVLLNPTD-----SSLPANNFTDTEAALSTPLESAD 63

  Fly    60 IPKLR-------TEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTV 117
            |||.|       .:::.|: ::.||.        ..:.|..|..|..::||..||..|.:.|:|.
Mouse    64 IPKARRKRYISQNDMIAIL-DYHNQV--------RGKVFPPAANMEYMVWDENLAKSAEAWAATC 119

  Fly   118 SFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD----------PRGL 172
            .:.|.. ...:||  :|:.|::...:|:     ::.::.|..:||   ::|          ||..
Mouse   120 IWDHGP-SYLLRF--LGQNLSVRTGRYR-----SILQLVKPWYDE---VKDYAFPYPQDCNPRCP 173

  Fly   173 LQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCR-QGSSSNFCHFLTC-YFDYDNVNGSYVY 235
            ::.|.|    :.:|:|.:|....:|:||.:....|.. .||......:|.| |....|..|...|
Mouse   174 MRCFGP----MCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPY 234

  Fly   236 KAGKPASSC-SDWGTTKSKEFANLCY 260
            |.|.|.||| ..:|...:.   |||:
Mouse   235 KVGVPCSSCPPSYGGACTD---NLCF 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/179 (22%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 38/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841276
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.