DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and PRY3

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:214 Identity:38/214 - (17%)
Similarity:64/214 - (29%) Gaps:82/214 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 PKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCR 125
            |...:::|...|.||......|                .:.|...||..|:::|...........
Yeast    23 PNFESDVLNEHNKFRALHVDTA----------------PLTWSDTLATYAQNYADQYDCSGVLTH 71

  Fly   126 STVRFPRVGECLAM-------------MVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFH 177
            |...:   ||.||:             .:.||.::                             :
Yeast    72 SDGPY---GENLALGYTDTGAVDAWYGEISKYNYS-----------------------------N 104

  Fly   178 PIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFDYDNVNGSY--------- 233
            |.....:.|||.:|....:.:|||...   |  |::.|  :::.|.:   |..|:|         
Yeast   105 PGFSESTGHFTQVVWKSTAEIGCGYKY---C--GTTWN--NYIVCSY---NPPGNYLGEFAEEVE 159

  Fly   234 --VYKAGKPASSCSDWGTT 250
              :......:||.|...||
Yeast   160 PLISTVSSSSSSSSSTSTT 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 29/173 (17%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 32/185 (17%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344580
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.