DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and PRY1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:168 Identity:35/168 - (20%)
Similarity:53/168 - (31%) Gaps:46/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 NQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMM 140
            :.|||... ...|:.....|....:.|...||..|:.:|.......|...|...:   ||.||  
Yeast   160 SDFASSVL-AEHNKKRALHKDTPALSWSDTLASYAQDYADNYDCSGTLTHSGGPY---GENLA-- 218

  Fly   141 VPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVSS---------HFTIIVSDRVS 196
                                   |....|..:...::.|.:|..|         |||.:|....:
Yeast   219 -----------------------LGYDGPAAVDAWYNEISNYDFSNPGFSSNTGHFTQVVWKSTT 260

  Fly   197 RVGCGVAVGTNCRQGSSSNFCHFLTCYFD-YDNVNGSY 233
            :||||:   ..|    ...:..::.|.:| ..|..|.|
Yeast   261 QVGCGI---KTC----GGAWGDYVICSYDPAGNYEGEY 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 31/157 (20%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 30/158 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344538
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.