DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crispld1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:234 Identity:55/234 - (23%)
Similarity:78/234 - (33%) Gaps:89/234 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            ||.:.|..|:|            .:..|..|..:.||.||...|.|.|....::|....   ..|
Mouse    65 ILDLHNKLRSQ------------VYPTASNMEYMTWDVELERSAESWAEMCLWEHGPAS---LLP 114

  Fly   132 RVGECLAMMVPKYK-HTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY------------- 182
            .:|:.|.....:|: .|.|      .:..:||                :||:             
Mouse   115 SIGQNLGAHWGRYRPPTFH------VQAWYDE----------------VRDFSYPYENECDPYCP 157

  Fly   183 ------VSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-------------FLTC-YFDYD 227
                  |.:|:|.:|....||:||.|            |.||             :|.| |....
Mouse   158 FRCSGPVCTHYTQVVWATSSRIGCAV------------NLCHNMNIWGQIWPKAVYLVCNYSPKG 210

  Fly   228 NVNGSYVYKAGKPASSC--SDWGTTKSKEFANLCYNNGN 264
            |..|...||.|:|.|:|  |..|..:.    ||||..|:
Mouse   211 NWWGHAPYKHGRPCSACPPSFGGGCRE----NLCYKEGS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/191 (21%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 39/190 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841234
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.