DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:224 Identity:55/224 - (24%)
Similarity:82/224 - (36%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 ILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFP 131
            ||.:.|..|:|            .:..|..|..:.||.||...|.|.|.:..::|....   ..|
Human    65 ILDLHNKLRSQ------------VYPTASNMEYMTWDVELERSAESWAESCLWEHGPAS---LLP 114

  Fly   132 RVGECLAMMVPKYK-HTVHEALKKMFKIMFDE-------HLHIQDPRGLLQGFHPIR--DYVSSH 186
            .:|:.|.....:|: .|.|      .:..:||       :.|..:|      :.|.|  ..|.:|
Human   115 SIGQNLGAHWGRYRPPTFH------VQSWYDEVKDFSYPYEHECNP------YCPFRCSGPVCTH 167

  Fly   187 FTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCH-------------FLTC-YFDYDNVNGSYVYKA 237
            :|.:|....:|:||.:            |.||             :|.| |....|..|...||.
Human   168 YTQVVWATSNRIGCAI------------NLCHNMNIWGQIWPKAVYLVCNYSPKGNWWGHAPYKH 220

  Fly   238 GKPASSC--SDWGTTKSKEFANLCYNNGN 264
            |:|.|:|  |..|..:.    ||||..|:
Human   221 GRPCSACPPSFGGGCRE----NLCYKEGS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/181 (22%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 39/180 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151157
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.