DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and AT5G02730

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_195893.1 Gene:AT5G02730 / 831820 AraportID:AT5G02730 Length:205 Species:Arabidopsis thaliana


Alignment Length:187 Identity:41/187 - (21%)
Similarity:64/187 - (34%) Gaps:41/187 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 KIPSLGGTRYHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSEN--RTFTQAKRMRQILWDSEL 106
            :.||..||       ..|..:....|..|..|....|..|..:.|  |..:.|..:|   ||..|
plant    28 EFPSTAGT-------SSPDTKAAAARATNRGRRNKQSAEFLLAHNAARVASGASNLR---WDQGL 82

  Fly   107 AYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQD--- 168
            |..|...|..   :.:.|:.|......||    .:.:|:.:.:.:.:::.....||.|:...   
plant    83 ARFASKWAKQ---RKSDCKMTHSGGPYGE----NIFRYQRSENWSPRRVVDKWMDESLNYDRVAN 140

  Fly   169 --PRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTN-------CRQGSSSNF 216
              ..|.:.|          |:|.||....:.|||..:...|       |....|.|:
plant   141 TCKSGAMCG----------HYTQIVWRTTTAVGCARSKCDNNRGFLVICEYSPSGNY 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 36/167 (22%)
AT5G02730NP_195893.1 SCP_PR-1_like 57..193 CDD:240181 33/151 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.