DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and AT4G33730

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:207 Identity:40/207 - (19%)
Similarity:73/207 - (35%) Gaps:66/207 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 YHAIVPDIPKLRTEILRIINNFRNQFASGAFRTSE--------------NRTFTQAKRMRQILWD 103
            :|.:.     :.|.:|.::.|:..|....:.:.|:              :.....|.:::.:.||
plant     2 FHKVA-----IETLVLLLLINYLTQIDVSSAQYSQYPQSHEYPDSYLRPHNAARAAVKVKPLRWD 61

  Fly   104 SELAYMARSHASTV-----SFQHTKCRSTVRFPRVGECLAM------MVPKYKHTVHEALKKMFK 157
            ..:|.:|:.:|:.:     |.:|:.       ...||.||.      ........|||   |.:.
plant    62 FGIATVAQDYANHLASGPCSLEHSS-------GPYGENLAFGSGDMSAAQAVAMWVHE---KSYY 116

  Fly   158 IMFDEHLHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTC 222
            ..:....|  .|             ...|:|.:|....:|:|||.|   .|..|:|...|     
plant   117 DFYSNSCH--GP-------------ACGHYTQVVWRGSARLGCGKA---KCNNGASIVVC----- 158

  Fly   223 YFDYDNVNGSYV 234
              :||.. |:|:
plant   159 --NYDPA-GNYI 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 35/185 (19%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 34/165 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.