DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and AT4G33720

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_195098.1 Gene:AT4G33720 / 829514 AraportID:AT4G33720 Length:163 Species:Arabidopsis thaliana


Alignment Length:192 Identity:37/192 - (19%)
Similarity:59/192 - (30%) Gaps:82/192 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 HAIVPDIPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVS 118
            |....|.|:   :.|.:.|..|.:...|..|                 ||.::|..||::|:   
plant    23 HLKAQDSPQ---DFLAVHNRARAEVGVGPLR-----------------WDEKVAAYARNYAN--- 64

  Fly   119 FQHTKCRSTVRFPRVGECLAMMVPKYKHT--------------------VHEALKKMFKIMFDEH 163
                        .|.|:| ||     ||:                    |...:.:.|...:|.:
plant    65 ------------QRKGDC-AM-----KHSSGSYGENIAWSSGSMTGVAAVDMWVDEQFDYDYDSN 111

  Fly   164 LHIQDPRGLLQGFHPIRDYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFD 225
            ....|.:             ..|:|.:|.....|:||   ....|..|.:     |:||.:|
plant   112 TCAWDKQ-------------CGHYTQVVWRNSERLGC---AKVRCNNGQT-----FITCNYD 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 33/180 (18%)
AT4G33720NP_195098.1 CAP_PR-1 30..163 CDD:349400 35/185 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.