DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and AT4G30320

DIOPT Version :10

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:156 Identity:32/156 - (20%)
Similarity:46/156 - (29%) Gaps:73/156 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMF 160
            |::.:.||::||..|:..|:               .|.|:|              ||        
plant    42 RLKPLKWDAKLARYAQWWAN---------------QRRGDC--------------AL-------- 69

  Fly   161 DEHLHIQDPRG--LLQG--------------FHPIRDY----------VSSHFTIIVSDRVSRVG 199
               .|...|.|  |..|              ....|.|          :..|:|.||.....::|
plant    70 ---THSNGPYGENLFWGSGNRWGPSQAAYGWLSEARSYNYRSNSCNSEMCGHYTQIVWKNTQKIG 131

  Fly   200 CGVAVGTNCRQGSSSNFCHFLTCYFD 225
            |...:   |..|...    ||||.:|
plant   132 CAHVI---CNGGGGV----FLTCNYD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 CAP_euk 64..225 CDD:349399 31/154 (20%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 32/156 (21%)

Return to query results.
Submit another query.