DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and AT4G07820

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_192524.1 Gene:AT4G07820 / 826263 AraportID:AT4G07820 Length:160 Species:Arabidopsis thaliana


Alignment Length:125 Identity:29/125 - (23%)
Similarity:39/125 - (31%) Gaps:49/125 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 RDYVSSHFTIIVSDRVS------------------RVGCGV---------AVGTNCRQGSSSNFC 217
            :||.::|....||..||                  |..||:         .:..:....|:..|.
plant    30 QDYFNAHNRARVSVGVSPLMWSQTLTAYAQAYAEKRRDCGLFLSGGPYGETIKADIIDFSAEEFV 94

  Fly   218 H-FLTCYFDYDNVNGSYVYKAGKPASSCSDW-----------GTTKSKEFANLCYNNGNL 265
            . ||....|||....:  .:|||   ||..:           |..|.|     |.|.|.|
plant    95 STFLNQKSDYDYTTNT--CRAGK---SCDGYKQVLFRKSVFLGCAKVK-----CNNGGFL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 14/72 (19%)
AT4G07820NP_192524.1 CAP_PR-1 29..160 CDD:349400 29/125 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.