powered by:
Protein Alignment CG43776 and AT2G19980
DIOPT Version :9
Sequence 1: | NP_001261162.1 |
Gene: | CG43776 / 14462630 |
FlyBaseID: | FBgn0264298 |
Length: | 270 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_179588.1 |
Gene: | AT2G19980 / 816517 |
AraportID: | AT2G19980 |
Length: | 165 |
Species: | Arabidopsis thaliana |
Alignment Length: | 31 |
Identity: | 9/31 - (29%) |
Similarity: | 18/31 - (58%) |
Gaps: | 7/31 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 PIRDYVSS-------HFTIIVSDRVSRVGCG 201
|..:|.:: |:|.||:::.:.:|||
plant 106 PYYNYATNKCSEPCGHYTQIVANQSTHLGCG 136
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43776 | NP_001261162.1 |
SCP_euk |
64..225 |
CDD:240180 |
9/31 (29%) |
AT2G19980 | NP_179588.1 |
SCP |
35..165 |
CDD:294090 |
9/31 (29%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X35 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.