DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and PRB1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:170 Identity:31/170 - (18%)
Similarity:51/170 - (30%) Gaps:73/170 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 NNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRVGEC 136
            |..|:|...|..:                 ||..||..||::|:.:.               |:|
plant    38 NQARSQIGVGPMQ-----------------WDEGLAAYARNYANQLK---------------GDC 70

  Fly   137 LAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDYVS----------------S 185
                     ..||.      :..:.|:|  ....|.|.|...:..:|:                .
plant    71 ---------RLVHS------RGPYGENL--AKSGGDLSGVAAVNLWVNEKANYNYDTNTCNGVCG 118

  Fly   186 HFTIIVSDRVSRVGCGVAVGTNCRQGSSSNFCHFLTCYFD 225
            |:|.:|.....|:||   ....|..|.:     .::|.:|
plant   119 HYTQVVWRNSVRLGC---AKVRCNNGGT-----IISCNYD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 30/168 (18%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 31/170 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.