DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crispld2

DIOPT Version :10

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:226 Identity:49/226 - (21%)
Similarity:75/226 - (33%) Gaps:76/226 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 RTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKC---R 125
            |.|||.:.|..|.|            .:..|..|..:.||.||...|.:.|....::|...   |
Mouse    56 RQEILMLHNKLRGQ------------VYPPASNMEHMTWDEELERSAAAWAHRCLWEHGPAGLLR 108

  Fly   126 STVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPIRDY-------- 182
            |      :|:.||:...:|:               ....|:|      ..:..::||        
Mouse   109 S------IGQNLAVHWGRYR---------------SPGFHVQ------SWYDEVKDYTYPYPHEC 146

  Fly   183 -----------VSSHFTIIVSDRVSRVGCGVAVGTNCRQ----GSSSNFCHFLTC-YFDYDNVNG 231
                       :.:|:|.:|....:::||.|   ..||.    |.:.....:|.| |....|..|
Mouse   147 TPRCRERCSGPMCTHYTQMVWATTNKIGCAV---HTCRNMNVWGDTWENAVYLVCNYSPKGNWIG 208

  Fly   232 SYVYKAGKPASSCSDWGTTKSKEFANLCYNN 262
            ...||.|:|.|.|       ...:...|.||
Mouse   209 EAPYKHGRPCSEC-------PSSYGGGCLNN 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 CAP_euk 64..225 CDD:349399 38/187 (20%)
Crispld2NP_001297564.1 CAP 56..201 CDD:412178 37/186 (20%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:427521
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.