DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Crisp4

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:83/223 - (37%) Gaps:56/223 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IPKLRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELA--------YMARSHAST 116
            |.:.:||....|.|..|     |||   .:....|:.|.::.|.|..|        |..:|.:.:
Mouse    77 ITESQTEPQEEIVNTHN-----AFR---RKVSPPARNMLKVSWSSAAAENARILARYCDKSDSDS 133

  Fly   117 VS--FQHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHPI 179
            :.  ..:|.|         ||  .|::..|.    .:..|:.:|.|:|..:.:      .|..|.
Mouse   134 LERRLPNTFC---------GE--NMLMEHYP----SSWSKVIEIWFNESKYFK------YGEWPS 177

  Fly   180 R--DYVSSHFTIIVSDRVSRVGCGVAVGTNCRQGSSSNF---CHFLTCYFDYDNVNGSYVYKAGK 239
            .  |..:.|:|.:|......|||.||.   ||:..::.:   ||:  |:........:..||.|.
Mouse   178 TDDDIETDHYTQMVWASTYLVGCDVAA---CRRQKAATYLYVCHY--CHEGNHQDTLNMPYKEGS 237

  Fly   240 PASSCSDWGTTKSKEFANLC-----YNN 262
            |...|.:  ..:.....|.|     |||
Mouse   238 PCDDCPN--NCEDGLCTNPCIYYDEYNN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 41/175 (23%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841339
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.