DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and Glipr1

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_006514280.1 Gene:Glipr1 / 73690 MGIID:1920940 Length:270 Species:Mus musculus


Alignment Length:222 Identity:42/222 - (18%)
Similarity:76/222 - (34%) Gaps:66/222 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VPDIPK--LRTEILRIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSF 119
            :|||..  ...|.:::.|..|::.:            ..|:.|..:.||.:||.:|::...:..|
Mouse    25 LPDITNEDFIKECVQVHNQLRSKVS------------PPARNMLYMSWDPKLAQIAKAWTKSCEF 77

  Fly   120 QHTKCRSTVRFPRVGECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQG-FHPIRDY- 182
            :|.                   |:....:|.....:.:.::...|.|......:.. :..|:.| 
Mouse    78 KHN-------------------PQLHSRIHPNFTALGENIWLGSLSIFSVSSAISAWYEEIKHYD 123

  Fly   183 --------VSSHFTIIVSDRVSRVGCGVAV---GTN--CRQGSSSNFCHFLTCYFDYDNVNGSYV 234
                    |..|:|.:|.....::||.|.:   |.|  |..|.:.|:              .::.
Mouse   124 FSTRKCRHVCGHYTQVVWADSYKLGCAVQLCPNGANFICDYGPAGNY--------------PTWP 174

  Fly   235 YKAGKPASSCSDWGTTKSKEFANLCYN 261
            ||.|...|.|    ....|...:||.|
Mouse   175 YKQGATCSDC----PKDDKCLNSLCIN 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 30/175 (17%)
Glipr1XP_006514280.1 CAP_GLIPR1-like 32..168 CDD:349404 29/166 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841318
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.