DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43776 and CRISP2

DIOPT Version :9

Sequence 1:NP_001261162.1 Gene:CG43776 / 14462630 FlyBaseID:FBgn0264298 Length:270 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:302 Identity:61/302 - (20%)
Similarity:104/302 - (34%) Gaps:92/302 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 AVLPVILMISTMTYGYNYCNNRTHRCILLNTQHFMCRLDKIPSLG-GTRYHAIVPDIPKLRTEIL 68
            |:|||:.:::.:                         |..:|:.| ...:.|::....:::.||:
Human     2 ALLPVLFLVTVL-------------------------LPSLPAEGKDPAFTALLTTQLQVQREIV 41

  Fly    69 RIINNFRNQFASGAFRTSENRTFTQAKRMRQILWDSELAYMARSHASTVSFQHTKCRSTVRFPRV 133
            ...|..|...:            ..|..|.::.|..|:...|:..|:..:.||:.........|.
Human    42 NKHNELRKAVS------------PPASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKTSTRC 94

  Fly   134 GECLAMMVPKYKHTVHEALKKMFKIMFDEHLHIQDPRGLLQGFHP-IRDYVSSHFTIIVSDRVSR 197
            ||.|      |..:...:.....:..:||.|      ..:.|..| ..:.|..|:|.:|.....:
Human    95 GENL------YMSSDPTSWSSAIQSWYDEIL------DFVYGVGPKSPNAVVGHYTQLVWYSTYQ 147

  Fly   198 VGCGVAVGTN------------C---------RQGSSSNFC-----HF--------LTCYFDYDN 228
            ||||:|...|            |         |:|.:...|     ||        ||  |..:|
Human   148 VGCGIAYCPNQDSLKYYYVCQYCPAMKTYLNKREGINVWKCFLRLRHFQLLRGEQLLT--FSGNN 210

  Fly   229 VNGSYV-YKAGKPASSCSD----WGTTKSKEFANLCYNNGNL 265
            :|.... |:.|.|.:.|.|    ...|.|.::.:|..|..:|
Human   211 MNRKNTPYQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDSL 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43776NP_001261162.1 SCP_euk 64..225 CDD:240180 40/195 (21%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 33/160 (21%)
Crisp 224..278 CDD:285731 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151283
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.